Invitrogen™ Human STIP1 (aa 303-398) Control Fragment Recombinant Protein

Product Code. 30212731

Brand: Invitrogen™ RP97460

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83700 (PA5-83700. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).

Specifications

• Accession Number: P31948
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10963
• Name: Human STIP1 (aa 303-398) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: epididymis secretory sperm binding protein Li 94 n; HEL-S-94 n; HOP; hsc70/Hsp90-organizing protein; Hsp70/Hsp90 organizing protein; Hsp70/Hsp90-organizing protein; IEF SSP 3521; IEF-SSP-3521; mSTI1; NY-REN-11 antigen; P60; Renal carcinoma antigen NY-REN-11; STI1; STI1L; Stip1; stress induced phosphoprotein 1; stress-induced phosphoprotein 1; stress-induced-phosphoprotein 1; stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein); stress-inducible protein; transformation-sensitive protein IEF SSP 3521
• Common Name: STIP1
• Gene Symbol: STIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining