Invitrogen™ Human STCH (aa 210-339) Control Fragment Recombinant Protein

Product Code. 30199734

Brand: Invitrogen™ RP90338

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53237 (PA5-53237. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STCH encodes a protein that is a member of the heat shock protein 70 family and is found associated with microsomes. Members of this protein family play a role in the processing of cytosolic and secretory proteins, as well as in the removal of denatured or incorrectly-folded proteins. The encoded protein contains an ATPase domain and has been shown to associate with a ubiquitin-like protein.

Specifications

• Accession Number: P48723
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6782
• Name: Human STCH (aa 210-339) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1600002I10Rik; AV006182; B230217N24Rik; Heat shock 70 kDa protein 13; heat shock protein 13; heat shock protein 70 family, member 13; heat shock protein 70 kDa family member 13; heat shock protein 70 kDa family, member 13; heat shock protein family A (Hsp70) member 13; Hspa13; microsomal stress 70 protein ATPase core; microsomal stress-70 protein ATPase core; STCH; stress 70 protein chaperone microsome-associated 60 kDa protein; stress 70 protein chaperone microsome-associated 60 kD human homolog; stress 70 protein chaperone, microsome-associated, 60 kD; stress 70 protein chaperone, microsome-associated, 60 kD human homolog; stress 70 protein chaperone, microsome-associated, 60 kDa; stress 70 protein chaperone, microsome-associated, human homolog; stress-70 protein chaperone microsome-associated 60 kDa protein; testis secretory sperm-binding protein Li 199 A
• Common Name: STCH
• Gene Symbol: Hspa13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining