Invitrogen™ Human STBD1 (aa 223-355) Control Fragment Recombinant Protein

Product Code. 30209715

Brand: Invitrogen™ RP90146

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52993 (PA5-52993. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as a cargo receptor for glycogen. Delivers its cargo to an autophagic pathway called glycophagy, resulting in the transport of glycogen to lysosomes. [UniProt]

Specifications

• Accession Number: O95210
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8987
• Name: Human STBD1 (aa 223-355) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D530019K15Rik; D5Ertd593e; genethonin 1; genethonin-1; GENEX3414; GENX-3414; Glycophagy cargo receptor stbd1; RGD1311800; starch binding domain 1; starch-binding domain-containing protein 1; Stbd1
• Common Name: STBD1
• Gene Symbol: STBD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: APVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining