Invitrogen™ Human STAT6 (aa 692-842) Control Fragment Recombinant Protein

Product Code. 30212621

Brand: Invitrogen™ RP94781

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81977 (PA5-81977. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STAT6 protein is a transcription factor activated by cytokines, particularly interleukin-4 and IL13. (Stat6-/-) were found to be deficient in IL-4-mediated functions including Th2 helper T-cell differentiation, expression of cell surface markers, T-cell proliferation, immunoglobulin class switching to IgE, and partial loss of IL-4 mediated proliferation. STAT6 mRNA has been detected in peripheral blood lymphocytes, colon, intestine, ovary, prostate, thymus, spleen, kidney, liver, lung and placenta. STAT6 is critically involved in Th2 immune response. STAT6 is crucial for IL-4-mediated biological responses, and naturally in two isoforms: STAT6a and STAT6c.

Specifications

• Accession Number: P42226
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6778
• Name: Human STAT6 (aa 692-842) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 12S1644; D12S1644; IL4 STAT; IL-4 Stat; IL-4-STAT; signal transducer and activator of transcription 6; signal transducer and activator of transcription 6, interleukin-4 induced; signal transducer and transcription activator 6; STAT; STAT, interleukin4-induced; Stat6; STAT-6; STAT6B; STAT6C; transcription factor IL-4 STAT
• Common Name: STAT6
• Gene Symbol: STAT6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining