Invitrogen™ Human STAT2 (aa 100-235) Control Fragment Recombinant Protein

Product Code. 30212618

Brand: Invitrogen™ RP94778

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STAT2 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus.

Specifications

• Accession Number: P52630
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6773
• Name: Human STAT2 (aa 100-235) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110034C02Rik; 1600010G07Rik; acute phase response factor; acute-phase response factor; ADMIO; ADMIO1; Aprf; AW109958; AW496480; DNA-binding protein APRF; EGK_03803; HIES; IMD44; interferon alpha induced transcriptional activator; ISGF-3; MGC59816; p113; signal transducer and activator of transcription 2; signal transducer and activator of transcription 2, 113 kDa; signal transducer and activator of transcription 3; signal transducer and activator of transcription 3 (acute-phase response factor); STAT; STAT 2; STAT113; STAT2; STAT-2; Stat3
• Common Name: STAT2
• Gene Symbol: Stat2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining