missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human STAT2 (aa 100-235) Control Fragment Recombinant Protein

Product Code. 30212618
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212618

Brand: Invitrogen™ RP94778

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STAT2 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P52630
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6773
Name Human STAT2 (aa 100-235) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110034C02Rik; 1600010G07Rik; acute phase response factor; acute-phase response factor; ADMIO; ADMIO1; Aprf; AW109958; AW496480; DNA-binding protein APRF; EGK_03803; HIES; IMD44; interferon alpha induced transcriptional activator; ISGF-3; MGC59816; p113; signal transducer and activator of transcription 2; signal transducer and activator of transcription 2, 113 kDa; signal transducer and activator of transcription 3; signal transducer and activator of transcription 3 (acute-phase response factor); STAT; STAT 2; STAT113; STAT2; STAT-2; Stat3
Common Name STAT2
Gene Symbol Stat2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.