Invitrogen™ Human STARD8 (aa 413-483) Control Fragment Recombinant Protein

Product Code. 30197204

Brand: Invitrogen™ RP100387

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63900 (PA5-63900. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a subfamily of Rho GTPase activating proteins that contain a steroidogenic acute regulatory protein related lipid transfer domain. The encoded protein localizes to focal adhesions and may be involved in regulating cell morphology. This protein may also function as a tumor suppressor.

Specifications

• Accession Number: Q92502
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9754
• Name: Human STARD8 (aa 413-483) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ARHGAP38; Deleted in liver cancer 3 protein; DLC3; DLC-3; KIAA0189; mKIAA0189; RGD1560770; StAR related lipid transfer domain containing 8; Stard8; StAR-related lipid transfer (START) domain containing 8; StAR-related lipid transfer domain containing 8; stAR-related lipid transfer protein 8; START domain containing 8; START domain-containing protein 8; STARTGAP3; START-GAP3
• Common Name: STARD8
• Gene Symbol: STARD8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAQDSEQEAHSGGEPTFASSLSVEEGHSISDTVASSSELDSSGNSMNEAEAAGPLAGLQASMPRERRDSGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining