Invitrogen™ Human STARD5 (aa 31-105) Control Fragment Recombinant Protein

Product Code. 30181824

Brand: Invitrogen™ RP98135

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59241 (PA5-59241. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols.

Specifications

• Accession Number: Q9NSY2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80765
• Name: Human STARD5 (aa 31-105) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 18B7-T7(GS); 2310058G22Rik; AI607880; D7Ertd152e; RGD1561783; StAR related lipid transfer domain containing 5; Stard5; StAR-related lipid transfer (START) domain containing 5; StAR-related lipid transfer domain containing 5; stAR-related lipid transfer protein 5; StAR-related protein 1-4 E; StAR-related protein p3-15 E/p3-16 E; START domain containing 5; START domain-containing protein 5
• Common Name: STARD5
• Gene Symbol: STARD5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining