Invitrogen™ Human STARD3NL (aa 1-53) Control Fragment Recombinant Protein

Product Code. 30206611

Brand: Invitrogen™ RP91136

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53953 (PA5-53953. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a late-endosomal protein that contains a conserved MENTAL (MLN64 N-terminal) domain. The encoded protein binds cholesterol molecules and may play a role in endosomal cholesterol transport through interactions with metastatic lymph node protein 64 (MLN64).

Specifications

• Accession Number: O95772
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83930
• Name: Human STARD3NL (aa 1-53) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610035N01Rik; 6530409L22Rik; AW124774; MENTHO; MGC3251; MLN64 N-terminal domain homolog; MLN64 N-terminal homolog; STARD3 N-terminal like; STARD3 N-terminal-like protein; STARD3NL; UNQ855/PRO1864
• Common Name: STARD3NL
• Gene Symbol: Stard3nl
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining