Invitrogen™ Human STAR (aa 196-269) Control Fragment Recombinant Protein

Product Code. 30198292

Brand: Invitrogen™ RP93804

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55581 (PA5-55581. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Steroidogenic acute regulatory protein (StAR) plays a significant role in cholesterol transport from the cytoplasmic outer membrane to the inner mitochondrial membrane. The 37 kDa precursor is cleaved to generate an active 28 kDa protein capable of facilitating cholesterol metabolism into pregnenolone. StAR is prevalently expressed in mitochondria of steroid-producing adrenal and gonadal tissue. Abnormalities in StAR gene expression are impacted in autosomal Lipoid Congenial Adrenal Hyperplasia (LCAH) resulting in defects in pregnenolone and cortisol synthesis. The mechanism of cholesterol binding to StAR has yet to be elucidated.

Specifications

• Accession Number: P49675
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6770
• Name: Human STAR (aa 196-269) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV363654; cholesterol trafficker; D8Ertd419e; lipid transporter; luteinizing hormone-induced protein; mitochondrial steroid acute regulatory protein; STAR; StAR related lipid transfer (START) domain containing 1; stARD1; StAR-related lipid transfer (START) domain containing 1; START domain containing 1; START domain-containing protein 1; steroid acute regulatory protein; steroidogenic acute regulator; steroidogenic acute regulatory protein; steroidogenic acute regulatory protein, mitochondrial; testis secretory sperm-binding protein Li 241 mP
• Common Name: STAR
• Gene Symbol: STAR
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFAN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining