Invitrogen™ Human STAMBPL1 (aa 126-203) Control Fragment Recombinant Protein

Product Code. 30203682

Brand: Invitrogen™ RP95840

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59103 (PA5-59103. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STAMBPL1 is zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains.

Specifications

• Accession Number: Q96FJ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57559
• Name: Human STAMBPL1 (aa 126-203) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700095N21Rik; 8230401J17Rik; ALMalpha; AMSH family protein; AMSH-family protein; AMSH-FP; AMSH-like protease; Amshlp; AMSH-LP; associated molecule with the SH3 domain of STAM (AMSH) - Family Protein; associated molecule with the SH3 domain of STAM (AMSH) like protein; bA399O19.2; KIAA1373; STAM binding protein like 1; STAM binding protein-like 1; STAM-binding protein-like 1; STAMBPL1
• Common Name: STAMBPL1
• Gene Symbol: STAMBPL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining