Invitrogen™ Human STAC (aa 221-290) Control Fragment Recombinant Protein

Product Code. 30200033

Brand: Invitrogen™ RP96355

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57175 (PA5-57175. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Promotes expression of the ion channel CACNA1H at the cell membrane, and thereby contributes to the regulation of channel activity. Plays a minor and redundant role in promoting the expression of calcium channel CACNA1S at the cell membrane, and thereby contributes to increased channel activity. Slows down the inactivation rate of the calcium channel CACNA1C. [UniProt]

Specifications

• Accession Number: Q99469
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6769
• Name: Human STAC (aa 221-290) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: SH3 and cysteine rich domain; SH3 and cysteine-rich domain-containing protein; Src homology 3 and cysteine-rich domain-containing protein; src homology three (SH3) and cysteine rich domain; Stac; STAC1
• Common Name: STAC
• Gene Symbol: STAC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining