Invitrogen™ Human Stabilin 2 (aa 352-437) Control Fragment Recombinant Protein

Product Code. 30199941

Brand: Invitrogen™ RP109302

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 15 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to bind and endocytose ligands such as hyaluronan, low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein has been shown to cycle between the plasma membrane and lysosomes.

Specifications

• Accession Number: Q8WWQ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55576
• Name: Human Stabilin 2 (aa 352-437) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 190 kDa form stabilin-2; 190 kDa hyaluronan receptor for endocytosis; CD44-like precursor FELL; DKFZP434E0321; FAS1 EGF-like and X-link domain containing adhesion molecule-2; FAS1 EGF-like and X-link domain-containing adhesion molecule 2; fasciclin egf-like, laminin-type egf-like, and link domain-containing scavenger receptor-2; fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 2; FEEL2; FEEL-2; FELE-2; FELL; FELL2; FELL-2; FE x 2; Hare; HAREFELL2; hepatic hyaluronan clearance receptor; hyaluronan receptor for endocytosis; hyaluronic acid receptor for endocytosis; MFEEL-2; SCARH1; scavenger receptor FEEL-2; Short form stabilin-2; stab2; STAB-2; stab2 {ECO:0000250; stabilin 2; Stabilin2; stabilin-2; UniProtKB:Q8WWQ8}
• Common Name: Stabilin 2
• Gene Symbol: STAB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGYVGDGLTCYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNVNELLVDNKAAQYFVKLH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining