Invitrogen™ Human ST3GAL5 (aa 236-333) Control Fragment Recombinant Protein

Product Code. 30200634

Brand: Invitrogen™ RP105461

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67026 (PA5-67026. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9UNP4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8869
• Name: Human ST3GAL5 (aa 236-333) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: [a]2; 3 S-T; alpha 2,3-sialyltransferase V; alpha2,3-sialyltransferase; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; Ganglioside GM3 synthase; GM3 synthase; GM3S; GM3-specific sialytransferase; lactosylceramide alpha-2,3-sialyltransferase; lactosylceramide alpha-2,3-sialyltransferas-like protein; mST3Gal V; SATI; Sialyltransferase 9; sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase); sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase); Siat9; SIATGM3S; ST3 beta-galactoside alpha-2,3-sialyltransferase 5; ST3 beta-galactoside alpha-23-sialyltransferase 5; ST3Gal V; ST3GAL5; ST3GalV; ST3GAL-V; UNQ2510/PRO5998
• Common Name: ST3GAL5
• Gene Symbol: ST3GAL5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining