Invitrogen™ Human ST3GAL3 (aa 29-99) Control Fragment Recombinant Protein

Product Code. 30202195

Brand: Invitrogen™ RP101251

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62317 (PA5-62317. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene.

Specifications

• Accession Number: Q11203
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6487
• Name: Human ST3GAL3 (aa 29-99) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: alpha 2,3-sialyltransferase III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; beta-galactoside alpha-2,3-sialyltransferase 3; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase soluble form; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; LOW QUALITY PROTEIN: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; EIEE15; gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; mental retardation, non-syndromic, autosomal recessive, 12; MRT12; N-acetyllacosaminide alpha 2,3-sialyltransferase; N-acetyllactosaminide alpha-2,3-sialyltransferase; sialyltransferase (N-acetyllacosaminide alpha 23-sialyltransferase); sialyltransferase 3; sialyltransferase 6; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); sialyltransferase 6(N-acetyllacosaminide alpha 23-sialyltransferase); sialyltransferase ST3Gal-III; Siat3; Siat6; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; ST3Gal III; St3gal3; ST3GALII; ST3GalIII; ST3N
• Common Name: ST3GAL3
• Gene Symbol: ST3GAL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining