missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ST3GAL3 (aa 29-99) Control Fragment Recombinant Protein

Product Code. 30202195
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202195

Brand: Invitrogen™ RP101251

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62317 (PA5-62317. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q11203
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6487
Name Human ST3GAL3 (aa 29-99) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alpha 2,3-sialyltransferase III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; beta-galactoside alpha-2,3-sialyltransferase 3; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase soluble form; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; LOW QUALITY PROTEIN: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; EIEE15; gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; mental retardation, non-syndromic, autosomal recessive, 12; MRT12; N-acetyllacosaminide alpha 2,3-sialyltransferase; N-acetyllactosaminide alpha-2,3-sialyltransferase; sialyltransferase (N-acetyllacosaminide alpha 23-sialyltransferase); sialyltransferase 3; sialyltransferase 6; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); sialyltransferase 6(N-acetyllacosaminide alpha 23-sialyltransferase); sialyltransferase ST3Gal-III; Siat3; Siat6; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; ST3Gal III; St3gal3; ST3GALII; ST3GalIII; ST3N
Common Name ST3GAL3
Gene Symbol ST3GAL3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.