Invitrogen™ Human ST3GAL2 (aa 32-171) Control Fragment Recombinant Protein

Product Code. 30208882

Brand: Invitrogen™ RP90346

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53571 (PA5-53571. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

Specifications

• Accession Number: Q16842
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6483
• Name: Human ST3GAL2 (aa 32-171) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3-sialytransferase; AI429591; alpha 2,3-sialyltransferase ST3Gal II; alpha 2,3-ST 2; alpha-2,3-sialyltransferase; AW822065; beta-galactoside alpha-2,3-sialyltransferase 2; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2; Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; gal-NAc6S; si:ch211-223o1.7; sialyltransferase 4 B; sialyltransferase 4 B (beta-galactosidase alpha-2,3-sialytransferase); sialyltransferase 4 B (beta-galactoside alpha-2,3-sialyltransferase); sialyltransferase 5; sialyltransferase ST3Gal-II; Siat4b; SIAT4-B; siat5; ST3 beta-galactoside alpha-2,3-sialyltransferase 2; ST3Gal II; st3Gal II0.2; St3gal2; st3gal2-r1; ST3GALA0.2; ST3GalII
• Common Name: ST3GAL2
• Gene Symbol: ST3GAL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining