Invitrogen™ Human ST14 (aa 89-167) Control Fragment Recombinant Protein

Product Code. 30209745

Brand: Invitrogen™ RP106140

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SOX2 is an intronless gene encoding a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of the SOX2 gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. The SOX2 gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). Further, SOX2 protein may act as a transcriptional activator after forming a protein complex with other proteins. Mutations in the SOX2 gene have been associated with bilateral anophthalmia, a severe form of structural eye malformation, optic nerve hypoplasia and syndromic microphthalmia.

Specifications

• Accession Number: Q9Y5Y6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6768
• Name: Human ST14 (aa 89-167) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ARCI11; Epithin; HAI; LOW QUALITY PROTEIN: suppressor of tumorigenicity 14 protein; matriptase; matriptase/MT-SP1; mCAP3; membrane-type serine protease; membrane-type serine protease 1; MTSP1; MT-SP1; MTSP-1; Prostamin; protease, serine, 14 (epithin); PRSS14; Serine protease 14; serine protease TADG-15; SNC19; ST14; ST14 transmembrane serine protease matriptase; suppression of tumorigenicity 14; suppression of tumorigenicity 14 (colon carcinoma); suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin); suppressor of tumorigenicity 14 protein; Suppressor of tumorigenicity 14 protein homolog; suppressor of tumorigenicity protein 14; TADG15; TADG-15; Tmprss14; tumor associated differentially expressed gene 15 protein; tumor-associated differentially-expressed gene 15 protein
• Common Name: ST14
• Gene Symbol: ST14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining