Invitrogen™ Human SSTR4 (aa 347-388) Control Fragment Recombinant Protein

Product Code. 30196381

Brand: Invitrogen™ RP103554

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SSTR4 has been reported to be expressed in brain, gastrointestinal tract, pancreas, and prostate tissues. No ESTs have been identified.

Specifications

• Accession Number: P31391
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6754
• Name: Human SSTR4 (aa 347-388) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G-protein coupled receptor; Smstr4; somatostatin receptor; somatostatin receptor 4; Somatostatin receptor subtype 4 Rattus norvegicus Sprague-Dawley major hippocampal somatostatin receptor (SSTR4) mRNA; somatostatin receptor type 4; SS4R; SS-4-R; SS4-R; sst4; Sstr4
• Common Name: SSTR4
• Gene Symbol: SSTR4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining