Invitrogen™ Human SSTR1 (aa 330-385) Control Fragment Recombinant Protein

Product Code. 30199817

Brand: Invitrogen™ RP95308

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Somatostatin acts to regulate numerous physiological processes by binding to and activating specific receptors in target tissues. Activation of these receptors by somatostatin, which is secreted by nerve and endocrine cells, regulates the secretion of insulin, glucagon and growth hormone, neuronal excitability in both the brain and the peripheral nervous system, and cell growth. Somatostatin receptors have been implicated in numerous diseases ranging from Alzheimer's to cancers of the gastrointestinal tract, breast, prostate, and pituitary.

Specifications

• Accession Number: P30872
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6751
• Name: Human SSTR1 (aa 330-385) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Gpcrrna; RNGPCRRNA; Smstr1; Smstr-1; somatostatin receptor; somatostatin receptor 1; Somatostatin receptor subtype 1; somatostatin receptor type 1; SRIF-2; SS1R; SS-1-R; SS1-R; sst1; Sst1 receptor; Sstr1
• Common Name: SSTR1
• Gene Symbol: SSTR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining