Invitrogen™ Human SSH3 (aa 429-505) Control Fragment Recombinant Protein

Product Code. 30199496

Brand: Invitrogen™ RP91579

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54118 (PA5-54118. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ADF (actin-depolymerizing factor)/cofilin family is composed of stimulus-responsive mediators of actin dynamics. ADF/cofilin proteins are inactivated by kinases such as LIM domain kinase-1 (LIMK1). The SSH family appears to play a role in actin dynamics by reactivating ADF/cofilin proteins in vivo.

Specifications

• Accession Number: Q8TE77
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54961
• Name: Human SSH3 (aa 429-505) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC028922; hSSH-3 L; mSSH-3 L; Protein phosphatase Slingshot homolog 3; slingshot 3; slingshot homolog 3; slingshot homolog 3 (Drosophila); slingshot protein phosphatase 3; slingshot-3 L; slingshot-like 3; Ssh3; SSH-3; Ssh3l; SSH-3 L; SSH-like protein 3
• Common Name: SSH3
• Gene Symbol: Ssh3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKVGGVSPEEHPAPEVSTPFPPLPPEPE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining