Invitrogen™ Human SSBP1 (aa 7-146) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30210063	100 μL	100µL

Product Code. 30210063 Supplier Invitrogen™ Supplier No. RP102227

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51759 (PA5-51759. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein binds preferentially and cooperatively to ss-DNA. Probably involved in mitochondrial DNA replication. SSBP is a housekeeping gene involved in mitochondrial biogenesis.

Specifications

• Accession Number: Q04837
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6742
• Name: Human SSBP1 (aa 7-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810480P10Rik; G630031O20Rik; mtDBP; mtSSB; Mt-SSB; PWP1-interacting protein 17; single strand DNA-binding protein P16; single stranded DNA binding protein 1; single-stranded DNA binding protein 1; single-stranded DNA binding protein 1, mitochondrial; single-stranded DNA-binding protein, mitochondrial; SOSS-B1; Ssbp; Ssbp1
• Common Name: SSBP1
• Gene Symbol: Ssbp1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining