missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198377

Invitrogen™ Human SRSF5 (aa 60-107) Control Fragment Recombinant Protein

Product Code. 30198377
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198377

Brand: Invitrogen™ RP100370

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60383 (PA5-60383. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SR proteins are a highly conserved family of arginine/serine-rich, spliceosome-associated phosphoproteins essential for metazoan pre-mRNA splicing. SR proteins act early in splicing by promoting splice site recognition and spliceosome assembly. SR proteins also play a regulatory role because they can determine alternative splice site usage in vivo and in vitro. SR proteins appear to be recruited from nuclear 'speckles', in which they are concentrated to sites of transcription in order to spatially coordinate transcription and pre-mRNA splicing within the cell nucleus.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13243
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6430
Name Human SRSF5 (aa 60-107) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Cl-4; Delayed-early protein HRS; Hrs; Insulin-induced growth response protein CL-4; pre-mRNA-splicing factor SRP40; serine and arginine rich splicing factor 5; serine/arginine-rich splicing factor 5; SFRS5; splicing factor arginine/serine-rich 5 (SRp40 HRS); splicing factor, arginine/serine-rich 5; splicing factor, arginine/serine-rich 5 (SRp40, HRS); SR splicing factor 5; SRp40; Srsf5
Common Name SRSF5
Gene Symbol SRSF5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.