Invitrogen™ Human SRSF11 (aa 140-254) Control Fragment Recombinant Protein

Product Code. 30203458

Brand: Invitrogen™ RP88824

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52606 (PA5-52606. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pre-mRNA splicing enhancer elements are short RNA sequences capable of activating weak splice sites in nearby introns that are required for accurate splice site recognition and the control of alternative splicing. Splicing enhancer elements contain specific binding sites for serine/arginine (SR)-rich splicing factors, which include SC35, 9G8, SRp20 and SF2/ASF. The family of SR factors all contain one or more RNA recognition motifs (RRM) and a SR-rich domain. The SR factor family is not only essential for constitutive splicing, but also regulate splicing in a concentration-dependent manner by influencing the selection of alternative splice sites. SFRS11 (splicing factor, arginine/serine-rich 11), also known as arginine-rich 54 kDa nuclear protein (p54) or NET2, is a 484 amino acid nuclear protein that colocalizes with spliceosome components and belongs to the splicing factor SR family. SFRS11 may function in pre-mRNA splicing and contains one RRM (RNA recognition motif) domain.

Specifications

• Accession Number: Q05519
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9295
• Name: Human SRSF11 (aa 140-254) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610009J05Rik; 2610019N13Rik; Arginine-rich 54 kDa nuclear protein; BF642805; dJ677H15.2; NET2; p54; serine and arginine rich splicing factor 11; serine/arginine-rich splicing factor 11; SFR11; Sfrs11; splicing factor p54; splicing factor, arginine/serine-rich 11; SR splicing factor 11; Srsf11
• Common Name: SRSF11
• Gene Symbol: SRSF11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSLKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining