Invitrogen™ Human SRPX2 (aa 35-129) Control Fragment Recombinant Protein

Product Code. 30204518

Brand: Invitrogen™ RP95439

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83439 (PA5-83439. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sushi-repeat-containing protein X-linked 2 (SRPX2) is a neural gene functioning in the speech and language center of the human brain; mutations in this gene lead to epilepsy, speech dyspraxia, mental retardation and cognitive disorders. Recently, SRPX2 was found to be a novel mediator of angiogenesis and can act as a ligand for the urokinase-type plasminogen activator, a protein that can facilitate invasive migration of sprouting endothelial cells. SRPX2 is also overexpressed in gastric cancer, leading to increased phosphorylation levels of focal adhesion kinase and enhanced cellular migration and adhesion, suggesting that SRPX2 may be a potential target in the treatment of metastatic cancers.

Specifications

• Accession Number: O60687
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27286
• Name: Human SRPX2 (aa 35-129) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110039C07Rik; BPP; CBPS; EMBL:AAI68975.1, ECO:0000312; PMGX; PubMed:24179158}; RESDX; RGD:1562444}; RGD1562444; RP11-524D16__A0.1; SRP; SRPUL; SRPX2; srpx2 {ECO:0000312; sushi repeat containing protein X-linked 2; sushi repeat containing protein, X-linked 2; sushi repeat-containing protein SRPX2; sushi repeat-containing protein SRPX2 {ECO:0000303; sushi-repeat containing protein; sushi-repeat containing protein, X-linked 2; sushi-repeat protein; sushi-repeat protein upregulated in leukemia; sushi-repeat protein up-regulated in leukemia; sushi-repeat-containing protein, X-linked 2
• Common Name: SRPX2
• Gene Symbol: SRPX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFIT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining