missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SRPX2 (aa 35-129) Control Fragment Recombinant Protein

Product Code. 30204518
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204518

Brand: Invitrogen™ RP95439

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83439 (PA5-83439. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sushi-repeat-containing protein X-linked 2 (SRPX2) is a neural gene functioning in the speech and language center of the human brain; mutations in this gene lead to epilepsy, speech dyspraxia, mental retardation and cognitive disorders. Recently, SRPX2 was found to be a novel mediator of angiogenesis and can act as a ligand for the urokinase-type plasminogen activator, a protein that can facilitate invasive migration of sprouting endothelial cells. SRPX2 is also overexpressed in gastric cancer, leading to increased phosphorylation levels of focal adhesion kinase and enhanced cellular migration and adhesion, suggesting that SRPX2 may be a potential target in the treatment of metastatic cancers.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60687
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27286
Name Human SRPX2 (aa 35-129) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110039C07Rik; BPP; CBPS; EMBL:AAI68975.1, ECO:0000312; PMGX; PubMed:24179158}; RESDX; RGD:1562444}; RGD1562444; RP11-524D16__A0.1; SRP; SRPUL; SRPX2; srpx2 {ECO:0000312; sushi repeat containing protein X-linked 2; sushi repeat containing protein, X-linked 2; sushi repeat-containing protein SRPX2; sushi repeat-containing protein SRPX2 {ECO:0000303; sushi-repeat containing protein; sushi-repeat containing protein, X-linked 2; sushi-repeat protein; sushi-repeat protein upregulated in leukemia; sushi-repeat protein up-regulated in leukemia; sushi-repeat-containing protein, X-linked 2
Common Name SRPX2
Gene Symbol SRPX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFIT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.