Invitrogen™ Human SRPK2 (aa 274-381) Control Fragment Recombinant Protein

Product Code. 30193881

Brand: Invitrogen™ RP91440

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54272 (PA5-54272. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SRPK2, along with SRPK1, is most likely the cellular protein kinase mediating HBV core protein phosphorylation during viral infection. It therefore represents an important host cell target for therapeutic intervention in HBV infection. Promotes neuronal apoptosis by up-regulating cyclin-D1 (CCND1) expression. This is done by the phosphorylation of SRSF2, leading to the suppression of p53/TP53 phosphorylation thereby relieving the repressive effect of p53/TP53 on cyclin-D1 (CCND1) expression. Phosphorylates ACIN1, and redistributes it from the nuclear speckles to the nucleoplasm, resulting in cyclin A1 but not cyclin A2 up-regulation. Plays an essential role in spliceosomal B complex formation via the phosphorylation of DDX23/PRP28. Plays a negative role in the regulation of HBV replication through a mechanism not involving the phosphorylation of the core protein but by reducing the packaging efficiency of the pregenomic RNA (pgRNA) without affecting the formation of the viral core particles .

Specifications

• Accession Number: P78362
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6733
• Name: Human SRPK2 (aa 274-381) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW226533; AW492537; AW547358; H_RG152G17.1 A; H_RG152G17.1 b; mSRPK2; serine kinase SRPK2; serine/arginine-rich protein specific kinase 2; serine/arginine-rich protein-specific kinase 2; serine/arginine-rich splicing factor kinase 2; serine/threonine-protein kinase SRPK2; SFRS protein kinase 2; SFRSK2; SR protein kinase 2; SRPK2; SR-protein-specific kinase 2; SRSF protein kinase 2; SRSF protein kinase 2 C-terminal; SRSF protein kinase 2 N-terminal; Wbp6; WUGSC:H_RG152G17.1 A; WW domain binding protein 6
• Common Name: SRPK2
• Gene Symbol: SRPK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KKQKRQAELLEKRLQEIEELEREAERKIIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDEDDVDQELANIDPTWIESP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining