Invitrogen™ Human SRGAP3 (aa 905-971) Control Fragment Recombinant Protein

Artikelnummer. 30212331

missing translation for 'mfr': Invitrogen™ RP102955

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60607 (PA5-60607. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GTPase-activating protein for RAC1 and perhaps Cdc42, but not for RhoA small GTPase. May attenuate RAC1 signaling in neurons. [UniProt]

Spezifikation

• Accession Number: O43295
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9901
• Name: Human SRGAP3 (aa 905-971) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI452337; ARHGAP14; brain stress early protein Gbi; D130026O08Rik; Gbi; Kiaa0411; KIAA1156; MEGAP; mental disorder-associated GAP; mKIAA0411; RGD1563152; rho GTPase activating protein 14; rho GTPase-activating protein 14; SLIT-ROBO Rho GTPase activating protein 2; SLIT-ROBO Rho GTPase activating protein 3; SLIT-ROBO Rho GTPase-activating protein 3; SRGAP2; srGAP3; WAVE-associated Rac GTPase activating protein; WAVE-associated Rac GTPase-activating protein; WRP
• Common Name: SRGAP3
• Gene Symbol: SRGAP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHSSLGDHKSLEAEALAEDIEKTMSTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining