Invitrogen™ Human SREK1IP1 (aa 1-52) Control Fragment Recombinant Protein

Product Code. 30211952

Brand: Invitrogen™ RP100552

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61066 (PA5-61066. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Possible splicing regulator involved in the control of cellular survival.

Specifications

• Accession Number: Q8N9Q2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 285672
• Name: Human SREK1IP1 (aa 1-52) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: p18 splicing regulatory protein; P18SRP; protein SFRS12IP1; protein SREK1IP1; SFRS12-interacting protein 1; SFRS12IP1; Splicing regulatory protein of 18 kDa; SREK1 interacting protein 1; SREK1-interacting protein 1; SREK1IP1
• Common Name: SREK1IP1
• Gene Symbol: SREK1IP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining