Invitrogen™ Human SRCRB4D (aa 523-574) Control Fragment Recombinant Protein

Product Code. 30200367

Brand: Invitrogen™ RP103456

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64037 (PA5-64037. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q8WTU2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 136853
• Name: Human SRCRB4D (aa 523-574) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Four scavenger receptor cysteine-rich domains-containing protein; S4D-SRCRB; S4-SRCRB; scavenger receptor cysteine rich domain containing, group B (4 domains); scavenger receptor cysteine rich family member with 4 domains; scavenger receptor cysteine rich family, 4 domains; scavenger receptor cysteine-rich domain-containing group B protein; scavenger receptor cysteine-rich protein SRCRB-S4D; SRCRB4D; SRCRB-S4D; SSC4D
• Common Name: SRCRB4D
• Gene Symbol: SSC4D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining