Invitrogen™ Human SRC2 (aa 764-834) Control Fragment Recombinant Protein

Product Code. 30208712

Brand: Invitrogen™ RP106993

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66314 (PA5-66314. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SRC2 (steroid receptor coactivator 2), also known as nuclear receptor coactivator2, NCOA2 or TIF2, aids in the function of nuclear hormone receptors. Nuclear hormone receptors are conditional transcription factors that play important roles in various aspects of cell growth, development, and homeostasis by controlling expression of specific genes. Members of the nuclear hormone receptor superfamily, which includes the 5 steroid receptors and class II nuclear receptors, are structurally characterized by 3 distinct domains: an N-terminal transcriptional activation domain, a central DNA-binding domain, and a C-terminal hormone-binding domain. Before the binding of hormone, steroid receptors, which are sometimes called class I of the nuclear hormone receptor family, remain inactive in a complex with heat-shock protein-90 and other stress family proteins. Binding of hormone induces critical conformational changes in steroid receptors that cause them to dissociate from the inhibitory complex, bind as homodimers to specific DNA enhancer elements associated with target genes, and modulate that gene's transcription. After binding to enhancer elements, transcription factors require transcriptional coactivator proteins to mediate their stimulation of transcription initiation.

Specifications

• Accession Number: Q15596
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10499
• Name: Human SRC2 (aa 764-834) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bHLHe75; c-fgr; Class E basic helix-loop-helix protein 75; c-src2; D1Ertd433e; FLJ43153; Glucocorticoid receptor-interacting protein 1; glucocorticoid receptor-interacting protein-1; Grip1; GRIP-1; hTIF2; I79_019839; KAT13C; MGC75096; NCOA2; NCoA-2; Nuclear receptor coactivator 2; p160 steroid receptor coactivator 2; p55c-fgr; p58c-fgr; SRC2; SRC-2; Steroid receptor coactivator 2; TIF 2; Tif2; transcriptional intermediary factor 2
• Common Name: SRC2
• Gene Symbol: NCOA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining