Invitrogen™ Human SR-BI Control Fragment Recombinant Protein

Product Code. 30206536

Brand: Invitrogen™ RP104112

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

High density lipoproteins (HDLs) play a critical role in cholesterol metabolism and their plasma concentrations are inversely correlated with risk for atherosclerosis. The SR-BI binds HDLs and mediates selective uptake of HDL cholesteryl ester. SR-BI binds HDL with high affinity, is expressed primarily in liver and nonplacental steroidgenic tissues, and mediates selective cholesterol uptake by a distinct mechanism. In mice, it seems that SR-BI plays a key role in determining the levels of plasma lipoprotein cholesterol and the accumulation of cholesterol stores in the adrenal gland.

Specifications

• Accession Number: Q8WTV0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 949
• Name: Human SR-BI Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI120173; CD36; CD36 and LIMPII analogous 1; CD36 antigen (collagen type I receptor thrombospondin receptor)-like 1 (scavanger receptor class B type 1); CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1; CD36 antigen (collagen type I receptor, thrombospondin receptor-like 1); CD36 antigen-like 1; Cd36l1; CD36-related class B scavenger receptor haSR-BI; CLA1; Cla-1; Collagen type I receptor, thrombospondin receptor-like 1; D5Ertd460e; haSR-bI; HDL QTL 1; Hdlq1; HDLQTL6; high density lipoprotein receptor; Hlb398; mSR-BI; Scarb1; scavanger receptor class B type 1; scavenger receptor b1; scavenger receptor class B member 1; scavenger receptor class B type I; scavenger receptor class B type II; scavenger receptor class B type III; scavenger receptor class B, member 1; scavenger receptor class B1; SRB1; SR-B1; SRBI; SR-BI; SR-BII
• Common Name: SR-BI
• Gene Symbol: SCARB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining