Invitrogen™ Human SPTAN1 (aa 2345-2470) Control Fragment Recombinant Protein

Product Code. 30210200

Brand: Invitrogen™ RP89536

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82320 (PA5-82320. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPTAN1 (spectrin alpha chain, non-erythrocytic 1) is a part of the spectrin family of filamentous cytoskeletal proteins. They function as essential scaffold proteins that stabilize the plasma membrane and organize intracellular organelles. Spectrins are composed of alpha and beta dimers that associate to form tetramers linked in a head-to-head arrangement. SPTAN1 has been implicated in other cellular functions including DNA repair and cell cycle regulation. Mutations in this gene are the cause of early infantile epileptic encephalopathy-5. Alternate splicing results in multiple transcript variants.

Specifications

• Accession Number: Q13813
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6709
• Name: Human SPTAN1 (aa 2345-2470) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: (ALPHA)II-SPECTRIN; 2610027H02Rik; A2a; a--fodrin; alpha; alpha II spectrin; alpha-fodrin; alpha-II spectrin; alpha-spectrin; alpha-spectrin 2; alpha-spectrin 2, brain; brain; brain alpha-spectrin; EIEE5; FLJ44613; Fodrin alpha chain; inhibitory protein factor; IPF; NEAS; noerythroid alpha-spectrin 2; Non erythrocytic spectrin alpha; non-erythrocytic 1 (alpha-fodrin); non-erythroid alpha chain; nonerythroid alpha-spectrin; nonerythroid alpha-spectrin 2; putative alpha-spectrin; SPECA; Spectrin; Spectrin alpha; spectrin alpha chain; Spectrin alpha chain brain; spectrin alpha chain, brain; spectrin alpha chain, non-erythrocytic 1; spectrin alpha, non-erythrocytic 1; spectrin, alpha, non-erythrocytic 1; spectrin, alpha, non-erythrocytic 1 (alpha-fodrin); spectrin, non-erythroid alpha chain; spectrin, non-erythroid alpha subunit; Spna2; Spna-2; Spta2; Sptan1
• Common Name: SPTAN1
• Gene Symbol: SPTAN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining