Invitrogen™ Human SPT5 (aa 948-1081) Control Fragment Recombinant Protein

Product Code. 30206680

Brand: Invitrogen™ RP91699

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56100 (PA5-56100. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences. [UniProt]

Specifications

• Accession Number: O00267
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6829
• Name: Human SPT5 (aa 948-1081) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL033283; AL033321; AU019549; DRB sensitivity-inducing factor 160 kDa subunit; DRB sensitivity-inducing factor large subunit; DSIF large subunit; DSIF p160; etID10129.15; etID37101.15; fb37g01; fb95e05; fog; foggy; hSPT5; protein foggy; Spt5; SPT5 homolog, DSIF elongation factor subunit; SPT5H; suppressor of Ty 5; suppressor of Ty 5 homolog; suppressor of Ty 5 homolog (S. cerevisiae); Supt5; Supt5h; supt5h protein; Tat-cotransactivator 1 protein; Tat-CT1; Tat-CT1 protein; Transcription elongation factor SPT5; transcription elongation regulator FOGGY; wu:fb37g01; wu:fb95e05; wu:fc10f02
• Common Name: SPT5
• Gene Symbol: SUPT5H
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining