Invitrogen™ Human SPSB3 (aa 124-257) Control Fragment Recombinant Protein

Product Code. 30209612

Brand: Invitrogen™ RP102071

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61257 (PA5-61257. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Specifications

• Accession Number: Q6PJ21
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90864
• Name: Human SPSB3 (aa 124-257) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310012N15Rik; 3300001M01Rik; C16orf31; Kiaa4204; mKIAA4204; splA/ryanodine receptor domain and SOCS box containing 3; SPRY domain-containing SOCS box protein 3; SPRY domain-containing SOCS box protein SSB-3; SPSB3; SSB3; SSB-3; Tce1
• Common Name: SPSB3
• Gene Symbol: SPSB3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKRFYPMVC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining