Invitrogen™ Human SPRY4 (aa 106-163) Control Fragment Recombinant Protein

Product Code. 30211647

Brand: Invitrogen™ RP108602

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111699 (PA5-111699. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPRY4 is an inhibitor of the receptor-transduced mitogen-activated protein kinase (MAPK) signaling pathway. The protein is positioned upstream of RAS activation and impairs the formation of active GTP-RAS.

Specifications

• Accession Number: Q9C004
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 81848
• Name: Human SPRY4 (aa 106-163) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A030006O18Rik; HH17; Protein sprouty homolog 4; Sprouty 4; sprouty homolog 4; sprouty homolog 4 (Drosophila); sprouty RTK signaling antagonist 4; sprouty4; Spry4; spry-4
• Common Name: SPRY4
• Gene Symbol: SPRY4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining