Invitrogen™ Human SPRR3 Control Fragment Recombinant Protein

Product Code. 30210199

Brand: Invitrogen™ RP89184

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60721 (PA5-60721. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPRR3 is the cross-linked envelope protein of keratinocytes.

Specifications

• Accession Number: Q9UBC9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6707
• Name: Human SPRR3 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 22 kDa pancornulin; cornifin beta; Esophagin; small proline rich protein 3; small proline-rich protein 3; SPR3; SPRC; SPRR3
• Common Name: SPRR3
• Gene Symbol: SPRR3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining