missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212300

Invitrogen™ Human SPPL3 (aa 282-314) Control Fragment Recombinant Protein

Product Code. 30212300
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212300

Brand: Invitrogen™ RP101387

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63803 (PA5-63803. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Signal peptide peptidase (SPP) is an aspartyl protease that mediates clearance of signal peptides by proteolysis within the endoplasmic reticulum (ER). Like presenilins, SPP contains a critical GXGD motif in its C-terminal catalytic center. SPPL3 is one of several presenilin homologues/SPP-like proteins (PSHs/SPPL) that have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TCT6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 121665
Name Human SPPL3 (aa 282-314) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833416I09Rik; fb94d08; Imp2; IMP-2; Intramembrane protease 2; MDHV1887; Presenilin homologous protein 1; presenilin-like protein 4; PRO4332; PSH1; PSL4; putative intramembrane aspartyl protease; RGD1562826; signal peptide peptidase 3; signal peptide peptidase like 3; signal peptide peptidase-like 3; signal peptide peptidase-like 3, pseudogene 1; Signal peptide peptidase-like 3-like protein; signal peptide peptidase-like protein 3; Sppl3; sppl3 protein; Sppl3-ps1; SPP-like 3; SPP-like 3 protein; upregulated during skeletal muscle growth 3; Usmg3; wu:fb94d08; zgc:114093
Common Name SPPL3
Gene Symbol SPPL3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLRYDNYKKQASGDSCGAPGPANISGRMQKVSY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.