Invitrogen™ Human SPPL2A (aa 31-99) Control Fragment Recombinant Protein

Product Code. 30212086

Brand: Invitrogen™ RP95841

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57509 (PA5-57509. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

By searching sequence databases for homologs of Dictyostelium discoideum Impas, which shares homology with presenilin, followed by PCR of lymphocyte and hippocampus cDNA libraries, Grigorenko et al. (2002) cloned SPPL2a. This protein, which may act as an intramembrane protease, contains an N-terminal protease-associated (PA) domain, several transmembrane regions, a hydrophilic loop, conservative sequences around the first and second aspartate residues, and an invariant PAL motif near the C terminus.

Specifications

• Accession Number: Q8TCT8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84888
• Name: Human SPPL2A (aa 31-99) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010106G01Rik; C130089K23Rik; IMP3; IMP-3; intramembrane cleaving protease; intramembrane protease 3; MNCb-3763; Presenilin-like protein 2; protein SPPL2a; PSEC0147; PSL2; RGD1563001; signal peptide peptidase like 2 A; signal peptide peptidase-like 2 A; SPPL2A; SPPL2a protein; SPP-like 2 A; SPP-like 2 A protein
• Common Name: SPPL2A
• Gene Symbol: SPPL2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining