Invitrogen™ Human SPON2 (aa 146-218) Control Fragment Recombinant Protein

Product Code. 30204944

Brand: Invitrogen™ RP105379

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66822 (PA5-66822. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cell adhesion protein that promotes adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. Essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens. Binds bacterial lipopolysaccharide (LPS).

Specifications

• Accession Number: Q9BUD6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10417
• Name: Human SPON2 (aa 146-218) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310045I24Rik; AI504350; differentially expressed in cancerous and non-cancerous lung cells 1; DIL1; DIL-1; DKFZp686G21139; FLJ16313; FLJ22401; FLJ34460; F-spondin; MINDIN; Mspondin; M-SPONDIN; SPON2; spondin 2; spondin 2, extracellular matrix protein; spondin-2; UNQ435/PRO866
• Common Name: SPON2
• Gene Symbol: SPON2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining