Invitrogen™ Human SPOCK2 (aa 162-249) Control Fragment Recombinant Protein

Product Code. 30212317

Brand: Invitrogen™ RP97046

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60775 (PA5-60775. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPOCK2 is a protein coding gene.

Specifications

• Accession Number: Q92563
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9806
• Name: Human SPOCK2 (aa 162-249) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA407235; FLJ97039; Gcap26; granule cell antiserum positive 26; KIAA0275; KIAA0275CWCV; mKIAA0275; sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2; sparc/osteonectin, cwcv and kazal-like domains proteoglycan 2; SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2; Spock2; Testican-2; TICN2; UNQ269/PRO306
• Common Name: SPOCK2
• Gene Symbol: SPOCK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining