Invitrogen™ Human SPINK6 Control Fragment Recombinant Protein

Artikelnummer. 30207524

Marke: Invitrogen™ RP90497

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52779 (PA5-52779. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPINK6 (serine peptidase inhibitor, Kazal type 6), also known as BUSI2, is an 80 amino acid secreted protein that contains one kazal-like domain and is thought to function as a serine protease inhibitor. The gene encoding SPINK6 maps to human chromosome 5, which contains 181 million base pairs and comprises nearly 6% of the human genome. Chromosome 5 is associated with Cockayne syndrome through the ERCC8 gene and familial adenomatous polyposis through the adenomatous polyposis coli (APC) tumor suppressor gene. Treacher Collins syndrome is also associated with chromosome 5 and is caused by insertions or deletions within the TCOF1 gene. Deletion of the p arm of chromosome 5 leads to Cri du chat syndrome, while deletion of the q arm or of chromosome 5 altogether is common in therapy-related acute mye-logenous leukemias and myelodysplastic syndrome.

Spezifikation

• Accession Number: Q6UWN8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 404203
• Name: Human SPINK6 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: acrosin inhibitor; BUSI2; EG433180; Kallikrein inhibitor; Kazal type serine protease inhibitor 1; protease inhibitor H; serine peptidase inhibitor, Kazal type 6; serine protease inhibitor Kazal-type 6; Spink5l1; Spink6; UNQ844; UNQ844/PRO1782
• Common Name: SPINK6
• Gene Symbol: SPINK6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining