Invitrogen™ Human SPG21 (aa 119-201) Control Fragment Recombinant Protein

Product Code. 30181437

Brand: Invitrogen™ RP98038

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59176 (PA5-59176. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene.

Specifications

• Accession Number: Q9NZD8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51324
• Name: Human SPG21 (aa 119-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: acid cluster protein 33; ACP33; BM-019; C78576; D9Wsu18e; GL010; Maspardin; MAST; spastic paraplegia 21 (autosomal recessive, Mast syndrome); Spastic paraplegia 21 autosomal recessive Mast syndrome protein; Spastic paraplegia 21 autosomal recessive Mast syndrome protein homolog; spastic paraplegia 21 homolog (human); Spastic paraplegia 21 protein; SPG21
• Common Name: SPG21
• Gene Symbol: SPG21
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining