missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182237

Invitrogen™ Human SPERT (aa 85-160) Control Fragment Recombinant Protein

Product Code. 30182237
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182237

Brand: Invitrogen™ RP97990

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59043 (PA5-59043. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPERT (spermatid associated protein), also known as CBY2 (chibby homolog 2) or NURIT, is a novel leucine-zipper protein belonging to the chibby family of proteins. Uniquely Expressed in the spermatid flower-like structure, SPERT interacts with Nek1, a member of the NIMA-family kinase family that is associated centrosomal stability and ciliogenesis. It contains a leucine-zipper motif and two coiled-coil regions, and is transcribed through the elongation stage of the spermatids. SPERT is absent from mature spermatozoa and is thought to be involved in transporting proteins that are to be discarded via the residual bodies.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NA61
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 220082
Name Human SPERT (aa 85-160) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700086N05Rik; AI596460; CBY2; chibby family member 2; chibby homolog 2; novel leucine zipper testicular protein; Nurit; Protein chibby homolog 2; protein nurit; spermatid associated; spermatid flower-like structure protein; spermatid-associated protein; Spert; testicular tissue protein Li 182; testis-specific leucine zipper protein nurit
Common Name SPERT
Gene Symbol SPERT
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ASQHSYPLNRFSSVPLDPMERPMSQADLELDYNPPRVQLSDEMFVFQDGRWVNENCRLQSPYFSPSASFHHKLHHK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.