Invitrogen™ Human SPERT (aa 179-267) Control Fragment Recombinant Protein

Product Code. 30182497

Brand: Invitrogen™ RP97989

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58752 (PA5-58752. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPERT (spermatid associated protein), also known as CBY2 (chibby homolog 2) or NURIT, is a novel leucine-zipper protein belonging to the chibby family of proteins. Uniquely Expressed in the spermatid flower-like structure, SPERT interacts with Nek1, a member of the NIMA-family kinase family that is associated centrosomal stability and ciliogenesis. It contains a leucine-zipper motif and two coiled-coil regions, and is transcribed through the elongation stage of the spermatids. SPERT is absent from mature spermatozoa and is thought to be involved in transporting proteins that are to be discarded via the residual bodies.

Specifications

• Accession Number: Q8NA61
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 220082
• Name: Human SPERT (aa 179-267) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700086N05Rik; AI596460; CBY2; chibby family member 2; chibby homolog 2; novel leucine zipper testicular protein; Nurit; Protein chibby homolog 2; protein nurit; spermatid associated; spermatid flower-like structure protein; spermatid-associated protein; Spert; testicular tissue protein Li 182; testis-specific leucine zipper protein nurit
• Common Name: SPERT
• Gene Symbol: SPERT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NKALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPRGKEDSTLQLLREENRALQQLLEQKQAY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining