missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Spectrin beta-4 (aa 2099-2196) Control Fragment Recombinant Protein

Product Code. 30197308
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197308

Brand: Invitrogen™ RP104041

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62972 (PA5-62972. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spectrin is the major constituent of the cytoskeletal network underlying the erthrocyte plasma membrane and determines cell shape, arrangement of transmembrane proteins and organization of organelles. It is expressed at very low levels in many tissues, with the strongest expression in the cerebellum, spinal cord, stomach, pituitary gland, liver, pancreas, salivary gland, kidney, bladder and heart. Spectrin beta 4 is a non-erythrocyte member, and is expressed in the brain and pancreatic islets and localisted to the nuclear matrix, cytoplasmic vesicles and PML nuclear bodies. Beta4 spectrins are also essential for membrane stability and the molecular organization of the nodes of Ranvier.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H254
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57731
Name Human Spectrin beta-4 (aa 2099-2196) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700022P15Rik; 5830426A08Rik; beta-IV spectrin; beta-spectrin 4; dyn; EMBL BAB83243.1; KIAA1642; lnd; lumbosacral neuroaxonal dystrophy; neuroaxonal dystrophy; nmf261; nmf379; quivering; qv; ROSA62; SpbIV; spectrin beta 4; spectrin beta chain, brain 3; spectrin beta chain, non-erythrocytic 4; spectrin beta, non-erythrocytic 4; spectrin, beta, non-erythrocytic 4; spectrin, non-erythroid beta chain 3; SPNB4; SPTBN3; SPTBN4
Common Name Spectrin beta-4
Gene Symbol SPTBN4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AWEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.