Invitrogen™ Human Spectrin beta-4 (aa 2099-2196) Control Fragment Recombinant Protein

Product Code. 30197308

Brand: Invitrogen™ RP104041

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62972 (PA5-62972. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spectrin is the major constituent of the cytoskeletal network underlying the erthrocyte plasma membrane and determines cell shape, arrangement of transmembrane proteins and organization of organelles. It is expressed at very low levels in many tissues, with the strongest expression in the cerebellum, spinal cord, stomach, pituitary gland, liver, pancreas, salivary gland, kidney, bladder and heart. Spectrin beta 4 is a non-erythrocyte member, and is expressed in the brain and pancreatic islets and localisted to the nuclear matrix, cytoplasmic vesicles and PML nuclear bodies. Beta4 spectrins are also essential for membrane stability and the molecular organization of the nodes of Ranvier.

Specifications

• Accession Number: Q9H254
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57731
• Name: Human Spectrin beta-4 (aa 2099-2196) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700022P15Rik; 5830426A08Rik; beta-IV spectrin; beta-spectrin 4; dyn; EMBL BAB83243.1; KIAA1642; lnd; lumbosacral neuroaxonal dystrophy; neuroaxonal dystrophy; nmf261; nmf379; quivering; qv; ROSA62; SpbIV; spectrin beta 4; spectrin beta chain, brain 3; spectrin beta chain, non-erythrocytic 4; spectrin beta, non-erythrocytic 4; spectrin, beta, non-erythrocytic 4; spectrin, non-erythroid beta chain 3; SPNB4; SPTBN3; SPTBN4
• Common Name: Spectrin beta-4
• Gene Symbol: SPTBN4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AWEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining