Invitrogen™ Human Spectrin beta-3 (aa 2130-2204) Control Fragment Recombinant Protein

Product Code. 30201376

Brand: Invitrogen™ RP103917

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58724 (PA5-58724. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spectrins are principle components of a cell's membrane-cytoskeleton and are composed of two alpha and two beta spectrin subunits. The protein encoded by this gene (SPTBN2), is called spectrin beta non-erythrocytic 2 or beta-III spectrin. It is related to, but distinct from, the beta-II spectrin gene which is also known as spectrin beta non-erythrocytic 1 (SPTBN1). SPTBN2 regulates the glutamate signaling pathway by stabilizing the glutamate transporter EAAT4 at the surface of the plasma membrane. Mutations in this gene cause a form of spinocerebellar ataxia, SCA5, that is characterized by neurodegeneration, progressive locomotor incoordination, dysarthria, and uncoordinated eye movements.

Specifications

• Accession Number: O15020
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6712
• Name: Human Spectrin beta-3 (aa 2130-2204) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: beta SpIII sigma 1; beta-III spectrin; beta-spectrin 3; glutamate transporter EAAT4-associated protein 41; GTRAP41; KIAA0302; mKIAA0302; SCA5; SCAR14; Spectrin Beta; spectrin beta 3; spectrin beta chain, brain 2; spectrin beta chain, non-erythrocytic 2; spectrin beta III sigma 2; spectrin beta, non-erythrocytic 2; spectrin, beta, non-erythrocytic 2; spectrin, non-erythroid beta chain 2; spectrin-like protein GTRAP41; spinocerebellar ataxia 5 protein; Spnb3; SPNB-3; SPTBN2
• Common Name: SPTBN2
• Gene Symbol: Sptbn2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining