Invitrogen™ Human Spectrin alpha-1 (aa 1022-1110) Control Fragment Recombinant Protein

Product Code. 30208024

Brand: Invitrogen™ RP94435

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82997 (PA5-82997. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spectrin is an actin crosslinking and molecular scaffold protein that links the plasma membrane to the actin cytoskeleton, and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. It is a tetramer made up of alpha-beta dimers linked in a head-to-head arrangement. This gene is one member of a family of alpha-spectrin genes. The encoded protein is primarily composed of 22 spectrin repeats which are involved in dimer formation. It forms weaker tetramer interactions than non-erythrocytic alpha spectrin, which may increase the plasma membrane elasticity and deformability of red blood cells. Mutations in this gene result in a variety of hereditary red blood cell disorders, including elliptocytosis type 2, pyropoikilocytosis, and spherocytic hemolytic anemia. [provided by RefSeq, Jul 2008]

Specifications

• Accession Number: P02549
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6708
• Name: Human Spectrin alpha-1 (aa 1022-1110) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610027H02Rik; A2a; AF093576; a--fodrin; AI451697; alpha II spectrin; alpha-fodrin; alpha-I spectrin; alpha-II spectrin; alpha-spectrin 1, erythroid; alpha-spectrin 2; alpha-spectrin 2, brain; brain alpha-spectrin; EIEE5; EL2; elliptocytosis 2; erythroid alpha-spectrin; erythroid spectrin alpha; fodrin alpha chain; ha; hemolytic anemia; HPP; HS3; ihj; inhibitory protein factor; IPF; mutant alpha spectrin; NEAS; neuroscience mutagenesis facility, 4; nmf4; noerythroid alpha-spectrin 2; nonerythroid alpha-spectrin 2; spectrin alpha 1; spectrin alpha chain, brain; spectrin alpha chain, erythrocyte; spectrin alpha chain, erythrocytic 1; Spectrin alpha chain, non-erythrocytic 1; spectrin alpha, erythrocytic 1; spectrin alpha, non-erythrocytic 1; spectrin, alpha, erythrocytic 1; spectrin, alpha, erythrocytic 1 (elliptocytosis 2); spectrin, alpha, non-erythrocytic 1; spectrin, non-erythroid alpha chain; spectrin, non-erythroid alpha subunit; sph; SPH3; spherocytosis; Spna1; Spna-1; Spna2; Spna-2; SPTA; Spta1; SPTA2; SPTAN1
• Common Name: Spectrin alpha-1
• Gene Symbol: SPTA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQEKKAENTGVEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining