Invitrogen™ Human SPDL1 (aa 298-390) Control Fragment Recombinant Protein

Product Code. 30207821

Brand: Invitrogen™ RP100099

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61667 (PA5-61667. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridizations indicate that this lectin is specifically expressed in keratinocytes. It is expressed at all stages of epidermal differentiation (i.e., in basal and suprabasal layers). The protein was found mainly in stratified squamous epithelium. It is moderately repressed by retinoic acid. The antigen localized to basal keratinocytes, although it was also found at lower levels in the suprabasal layers, where it concentrated to areas of cell-to-cell contact. The cellular localization and its striking down-regulation in cultured keratinocytes imply a role in cell-cell and/or cell-matrix interactions necessary for normal growth control.

Specifications

• Accession Number: Q96EA4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54908
• Name: Human SPDL1 (aa 298-390) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700018I02Rik; 2600001J17Rik; 2810049B11Rik; AA409762; arsenite-related gene 1 protein; Ccdc99; coiled-coil domain containing 99; coiled-coil domain-containing protein 99; coiled-coil domain-containing protein 99 {ECO:0000255; HAMAP-Rule:MF_03041}; hSpindly; protein Spindly; RGD1306908; Rhabdomyosarcoma antigen MU-RMS-40.4 A; rrhabdomyosarcoma antigen protein MU-RMS-40.4 A; SPDL1; Spindle apparatus coiled-coil domain-containing protein 1; spindle apparatus coiled-coil domain-containing protein 1 {ECO:0000255; spindle apparatus coiled-coil protein 1; spindly homolog
• Common Name: SPDL1
• Gene Symbol: SPDL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQIATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSMESKPSVDSGTLEDNTYYTDLLQMKLDNLNKEIESTKGELS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining