Invitrogen™ Human SPATA7 (aa 409-504) Control Fragment Recombinant Protein

Product Code. 30199298

Brand: Invitrogen™ RP95556

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58241 (PA5-58241. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of the SPATA7 protein remains unknown.

Specifications

• Accession Number: Q9P0W8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55812
• Name: Human SPATA7 (aa 409-504) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI661438; B230306G18Rik; epididymis secretory protein Li 296; fertility related protein WMP1; fertility-related protein WMP1; HEL-S-296; HSD3; HSD-3.1; LCA3; RSD-3; si:ch211-51o12.1; SPATA7; sperm DNA no0.3; spermatogenesis associated 7; spermatogenesis-associated protein 7; Spermatogenesis-associated protein 7 homolog; spermatogenesis-associated protein 7 homolog; spermatogenesis-associated protein 7; spermatogenesis-associated protein HSD3; Wmp1
• Common Name: SPATA7
• Gene Symbol: SPATA7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining