missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212188

Invitrogen™ Human SPATA4 (aa 213-300) Control Fragment Recombinant Protein

Product Code. 30212188
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212188

Brand: Invitrogen™ RP92056

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53959 (PA5-53959. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The testis spermatocyte apoptosis-related gene 2 protein (TSARG2, also designated spermatogenesis associated-4 or SPATA4) is involved in spermatogenesis. TSARG2 is specifically expressed in spermatogonia and spermatocytes of the seminiferous tubules, and it localizes to the nucleus. The predicted molecular weight of TSARG2 ranges depending on the species. TSARG2 is significantly upregulated in cryptorchidism and therefore, is a testis-specific apoptosis candidate oncogene.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q8NEY3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 132851
Name Human SPATA4 (aa 213-300) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700001N01Rik; Spata4; SPEF1B; spermatogenesis associated 4; spermatogenesis related gene 2; spermatogenesis-associated 4; spermatogenesis-associated protein 4; Spermatogenesis-related gene 2 protein; Srg2; testis and spermatogenesis cell related protein 2; testis and spermatogenesis cell-related protein 2; Testis spermatocyte apoptosis-related gene 2 protein; TSARG2
Common Name SPATA4
Gene Symbol SPATA4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.